PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.6NG144600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 234aa    MW: 26894.4 Da    PI: 9.8329
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.6NG144600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF82.33.2e-26959151
                         S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
               SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                         kri+n + rqvtfskRr g++KKA+EL +LCdaev +i+fsst++ly+++s
  Pavir.6NG144600.1.p  9 KRIDNATSRQVTFSKRRSGLFKKAKELAILCDAEVGLIVFSSTDRLYDFAS 59
                         79***********************************************86 PP

2K-box74.62.7e-2580170898
                K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkk 97 
                            ++a+a+ +q+e+  L+++++nLq+ qR+llG++L+ L++k+Lq+Le++Le sl++iR kK++l+++ i+el +k   +++en +L +k
  Pavir.6NG144600.1.p  80 MSASAEAKLWQREAGSLRQQLHNLQEHQRQLLGQQLSGLDVKDLQNLENKLEMSLRNIRMKKDQLVTDRIQELNRKGSLMHQENIELYNK 169
                          36788999*******************************************************************************999 PP

                K-box  98 l 98 
                          +
  Pavir.6NG144600.1.p 170 V 170
                          7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.7E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.029161IPR002100Transcription factor, MADS-box
CDDcd002651.22E-43277No hitNo description
SuperFamilySSF554553.79E-32290IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-28323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004046.9E-283859IPR002100Transcription factor, MADS-box
PfamPF014864.7E-2583170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.70186176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 234 aa     Download sequence    Send to blast
MGRGKIEIKR IDNATSRQVT FSKRRSGLFK KAKELAILCD AEVGLIVFSS TDRLYDFAST  60
SMKSVIERYS EAKEDHHETM SASAEAKLWQ REAGSLRQQL HNLQEHQRQL LGQQLSGLDV  120
KDLQNLENKL EMSLRNIRMK KDQLVTDRIQ ELNRKGSLMH QENIELYNKV NLVHQENIEL  180
RRKVYGHGVN EHPARSTVRH GILNTENEDV LVNLELRQPR SVQRDKSETP STG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P4e-23176176Myocyte-specific enhancer factor 2B
1tqe_Q4e-23176176Myocyte-specific enhancer factor 2B
1tqe_R4e-23176176Myocyte-specific enhancer factor 2B
1tqe_S4e-23176176Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973502.11e-153PREDICTED: MADS-box transcription factor 23-like
SwissprotQ6EP496e-94MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLA0A0E0ELT71e-118A0A0E0ELT7_9ORYZ; Uncharacterized protein
STRINGOB08G23110.11e-115(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP61435130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.18e-82AGAMOUS-like 16